PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN16421.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 257aa    MW: 28391.5 Da    PI: 8.5631
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN16421.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1252.4e-392080262
      zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                ++++l+cprC stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rknk+++
  KHN16421.1 20 PQEQLNCPRCSSTNTKFCYYNNYSLTQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRVT 80
                6899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-271578IPR003851Zinc finger, Dof-type
PfamPF027012.1E-332278IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.0312478IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102662IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MEDIGPNSCT RPVTEKKARP QEQLNCPRCS STNTKFCYYN NYSLTQPRYF CKTCRRYWTE  60
GGSLRNVPVG GGSRKNKRVT SSKVPDLNPP ISLSSVSAIS SQNPKMQGVH DLNLAFPAAM  120
DKYHHGTSPY VEMPKLEIGG DHSTSHHSHH HSHSPSSAVE LLRSGMDSRG LNPYAPNSLM  180
SGSDHSLYTP GYPMQEIKPN LSFSVDDGFG NRSYGVQENG GGRLLFPFGD IKHLSAGLEV  240
EHNKEQGNNS TGYWTGW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8572680.0DQ857268.1 Glycine max Dof18 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003520878.10.0PREDICTED: dof zinc finger protein DOF2.5-like isoform X1
RefseqXP_006577350.10.0PREDICTED: dof zinc finger protein DOF2.5-like isoform X2
RefseqXP_006577351.10.0PREDICTED: dof zinc finger protein DOF2.5-like isoform X2
SwissprotQ9ZPY02e-59DOF25_ARATH; Dof zinc finger protein DOF2.5
TrEMBLA0A0B2Q4C40.0A0A0B2Q4C4_GLYSO; Dof zinc finger protein DOF2.5
TrEMBLI1JS120.0I1JS12_SOYBN; Uncharacterized protein
TrEMBLK7KH420.0K7KH42_SOYBN; Uncharacterized protein
STRINGGLYMA03G41980.30.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67434137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.45e-66Dof family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]